ATM Statement on the 1st Anniversary of the TAMASCO Massacre

November 28, 2018

ATM stands with the T’boli-Ubo-Manobo tribe from Brgy. Ned, Lake Sebu, South Cotabato, as they continue to seek justice for the killing of Datu Victor Danyan and seven of his companions.  They were all members of the T’boli Manobo S’daf Claimants Organization (TAMASCO), and are resisting the illegal coffee plantation operated by Consunji-owned Silvicultural Industries (SII). 

As ATM, we reflect that the stand against destructive mining is a stand for the right to self-determination of indigenous peoples. This resistance of TAMASCO against an illegal forestry management agreement by a coffee plantation company is the same resistance to an extractivist project like large-scale mining.

The struggle of TAMASCO is the genuine and often dangerous struggle of indigenous peoples to protect their lands and assert their right to self-determination of their future, within their ancestral domain.  Because of their courageous stand, they were gunned down mercilessly last Dec. 3, 2017.

The TAMASCO massacre reflects the high price that lumadspay in order to assert their indigenous rights.  ATM condemns this senseless violence against lumads, a story repeated in many other mining-affected communities.

ATM joins the demands of the affected communities and their support groups.  As Task Force TAMASCO, we demand that government agencies must be held accountable.  DENR must immediately cancel IFMA No. 18-2007, which was illegally merged with the expired IFMA No. 22.  NCIP must ensure that TAMASCO members are protected and enjoy the fruits of their ancestral domain.  The CHR must step in and resolve the case immediately, in favor of TAMASCO, and provide sanctuary for witnesses and survivors.  The AFP and the PNP must investigate and hold accountable those who perpetrated these heinous human rights violations.

TAMASCO has clearly said NO already and for so many times! No to the IFMA and the coffee plantation!  No to the continued harassment and threats!  No to the destruction of their ancestral domains! No to the cultural displacement they are facing!

The government must listen and respect the right to say NO! of TAMASCO and all indigenous communities. (By Danny Arias, Mindanao Campaign Coordinator)

ARMM students get recognition in national and international competitions

Cotabato City (November 28, 2018) – Student representatives from the Autonomous Region in Muslim Mindanao (ARMM) brought pride to the Bangsamoro after bagging medals in different national and international competitions.

Student awardees were Ricco Teraytay from Camp Siongco National High School, a finalist who competed in the 2018 World Taekwondo Poomsae Championships from November 15 to 18 in Taipei, Taiwan; Yahser Malang from ARMM Regional Science High School, top two grand-finalist in Southeast Asia Video Festival held on November 24 in Manila; and five students from Parang National High School who bagged the grand champion in Science Investigatory Project on November 16 in Olongapo City.

All the awardees said bringing the banner and pride of the Bangsamoro is a strong statement that people in the ARMM have many to offer. “I am really proud dahil bilang isang taga ARMMang sarap sa pakiramdam na i-represent ang lugar ko (Maguindanao) at ang bansang Pilipinas,” said Teraytay who was included in the top 10 under 17 junior male team.

ARMM’s Education department secretary Atty. Rasol Mitmug Jr. noted that the ARMM government has consistently been supportive of these outstanding students.

“Yun po yung masarap sa pakiramdam, dahil may direct communication po kami ni Secretary Mitmug at lagi po nya akong mino-monitor kaya malaking tulong po iyon para makarating ako sa ibang bansa,” Teraytay said. Thousands of athletes from 59 countries joined the 2018 World Taekwondo Poomsae Championships.

Moreover, students from ARMM Regional Science High School bagged the championship in a video competition under the theme ‘Everyday’s Hero’ children category for their video entitled 'Super Guro'.

Sinebata 2018 is a competition of creators of videos for and by children from the Philippines convened by Anak TV, an advocacy organization that promotes television literacy and child-sensitive, family-friendly television in the Philippines.

Apart from receiving trophies and other prizes, the team placed second in the Second Southeast Asia Video Festival for Children – also known as Southeast Asia Prix Jeunesse. The competition’s participants were from Brunei, Cambodia, Indonesia, Lao PDR, Malaysia, Myanmar, Philippines, Singapore, Thailand, and Vietnam.

“Nakaka-proud po na dala-dala namin ang banner ng ARMM at ng Pilipinas at maipagmamalaki na maraming may angking talento dito sa lugar natin,” Malang said.

For the grand champion in Science investigatory project, students from Parang National High School said it is an honor to represent the region in a science competition. The team’s grand champion project is an anti-theft door alarm. Sec. Mitmug commended the students for their achievements.

After receiving the award, the students said they are hoping their success will also inspire other students to develop their skills to investigate scientifically and make investigatory projects as part of their learning.

In his message, Secretary Mitmug emphasized that the regional government is confident that the students in ARMM would also participate successfully in future national and international activities. (By JONG CADION) with Bureau of Public Information)

Pagdiriwang sa kapistahan ng Maranding nagging matagumpay

Ni Mike Navarro

MARANDING, LALA, Lanao del Norte (Nov. 28, 2018)- NAGING matagumpayangisanglinggongselebrasyonsapagdiriwang ng taunangkapyestahan ng Kristong Hari patron ng Brgy. MarandingnoongnakalipasnaNobyembre 24 at 25.

Ayun kay Dr. Ma. Esperanza A. Sanchez CKCM Vice President for Research, Extension and Development/Dean of Sudents Affairs namas masayaangpagdiriwangnitongtaon.

Hinikayat din nitoangmgakabataan at mga mag-aaralna mas paiigtiinangpagmamahalsapamilya at saDiyos.Dagdag pa nitona mas lalosilangnatutuwangayundahilsapinakitangpagkakaisa ng mgakabataan at pagsunodsamgaaralmulasabibliya.

Isa ang Christ the King sapinakamalakingsimbahangkatolikosa Lanao del Norte at ang Christ the King College de Marandingbilangisasapinakamalakingpaaralansaprobinsya.

Nagingmakukulay at magangandaangunangparadanasinalihan ng iba'tibangbandasaiba'tibangpaaralangaya ng CKCM,NCMC,Lala National at iba pa.Nagpatalbugan din sakanilang dance performance angmga mag-aaral.

Samantalangtumulongnamansapagbibigay ng seguridadangmgastudyantemulasa Criminology department ng Christ the King College de Marandingsadadaanan ng parada.

Attachments photo. 

Pagpatayo ng bagongopisina ng LTO Tubodmalapit ng umpisahan

 Ni Mike Navarro

TUBOD, Lanao del Norte (Nov. 28, 2018) -Malapit ng umpisahanangpagtatayo para sabagongopisina ng Land Transportation Office saTubod Lanao del Norte.

Ayun kay LTO Tubod district office head Malic Sultan,nagpalabasna ng notice to proceed angopisinani LTO OIC Regional Director Rhodelio V.Poliquitmataposmanaloang TESAR construction para sapagtatayo ng nabanggitnagusali.

Binisitani Engr.Taguranao 'Teddy' Gampong ng TESAR Construction anglugar kung saanitatayoangbagongopisina ng LTO saSagadanTubod, Lanao del Norte.

Kasamasina LTO Tubod district head Malic Sultan at Manny Sumpingan head ng Operation.

Samantalangpinurinaman ng mgaopisyal ng probinsya at magingang regional director ng LTO si Malic Sultan dahilsamagandangpamamalakadnitosakanyangopisina at angmahigpitnakampanyanitokontrasa illegal fixers at angtuloytuloynamga road operation na kung saanmadalasnanahuhuliangmga nag momotornawalangmgalisensya.

Patuloynamansakanyangpanawaganni LTO Tubod district head Malic Sultan salahat ng nagmomotornapalagingmagsusuot ng helmet para na din saproteksyonnitodahilkadalasanangmga single motor angnadidisgrasya at angibanamannamamataydahilnabagokangulosasementodahilhindinagsusuot ng helmet.

Pinayuhan din nitoangmgamagulangsamgakabataannahanggatmaarihuwaghayaangmagdriveangmgaanaknitonawalangmgalisensya at lalonayungmganakainom.Mas lalo pa nilangpahihigpitinangpagpapatupadsabatastrapiko para maiwasanangmgaaksidentenamadalasmgakabataanangsangkot.

Attachments with photos

687 New Police Recruits Take Oath in PRO9

By JONG CADION

PAGADIAN CITY (Nov. 29, 2018) - Some 687 police recruits took their oath before their family and love ones as new members of the Police Regional Office 9 (PRO9) in a simple ceremony held at the PRO9 Multi-Function Hall, Camp Col. Romeo A Abendan, Mercedes, Zamboanga City on Wednesday, November 28, 2018, police regional official disclosed.

PRO9 PIO Chief PCINSP Helen L. Galvez said that Police Chief Supt. Emmanuel Luis D Licup, PRO9 Regional Director, administered the oath-taking of the rookie policemen following their presentation by Police Senior Supt. Romulo Cleve N Taboso, Chief of the Regional Police Personnel and Human Resource Development Division (RPHRDD).

Galvez added that of the 687 new police recruits, 547 are males and 140 are females. They were assumed the rank of Police Officer 1 (PO1) and receive a basic monthly salary of P29, 668 aside from allowances and other non-cash benefits.

Galvez also said that the newly police recruits who came from the different city/provinces in the region were chosen after a tough screening process conducted by the Regional Screening Committee on Recruitment headed by Police Chief Supt. Edwin S De Ocampo, Deputy Regional Director for Administration.

The 687 rookie police officers were turned over to the Regional Training School 9 and were received by Police Superintendent Marlon L Quimno, Regional Training Director where they will undergo one-year training at the Regional Training School 9 in Camp Felisizimo Marcos, Pasonanca, Zamboanga City, Galvez said.

PIO Chief explained that the hiring of the 687 applicants is part of the PO1 Regular Recruitment Program of the PNP for the year 2018 of the Police Regional Office 9. (With PRO9 PR and photos)

12 NPA Organizers Surrenders in Lanao del Sur

PAGADIAN CITY, Zamboanga del Sur (Nov. 29, 2018) - Twelve Communist NPA Terrorist (CNT) organizing group surrendered to 82nd Infantry Battalion of Joint Task Force Ranao in hinterlands of Kapai and Tagoloan all of Lanao del Sur Monday, military official said.

"The surrenderees were organized by Semi Legal Team, Guerilla Front 12, North Central Mindanao Regional Committee,” said Lt. Col. Jayson Jumawan, 82nd Infantry Battalion Commander.

The CNT organizing group also surrendered two firearms, one caliber 30 carbine rifle and one caliber 45 pistol.

Custodial debriefing is still on-going as of this posting.

Last November 10, 2018, one NPA leader in Tagoloan, LDS was killed in an encounter with 65th Infantry Battalion, operationally controlled by 4th Infantry Division based in Cagayan de Oro city.

Major General Roseller Murillo, the 1st Infantry Division and Joint Task Force  Zampelan (Zamboanga Peninsula and Lanao Provinces) Commander commended the troops for their efforts that led to the surrender of the 12 NPA organizing group.

"Our campaign against Communist NPA Terrorists and Local Terrorists Group in our area of operation is relentless and will continue to insulate communities from their terroristic activities," said Major General Murillo.

"We will also complement our operations with other Infantry Divisions to isolate and destroy them to attain just and lasting peace in the AO," He added. (By JONG CADION)

Marine Troops neutralize Basilan-Based Abu

By JONG D. CADION

PAGADIAN CITY CITY (Nov.24, 2018) – The Operating elements of Marine Battalion Landing team 11 under Joint Task Force Zamboanga conducting legitimate military operations in the vicinity off Sitio Logon, Brgy Limaong, Zamboanga City on Friday, Nov 23, 2018 encountered and neutralized ASG member, identified as alias Abu Nibras under basilan-based ASG Subleader Abdullah Indanan, Navy official disclosed.

Naval Forces Western Mindanao (NFWM) Commander Rear Admiral Rene V. Medina said that the conduct of military operations was due to the reported sightings of unidentified armed individuals in the area. A firefight which lasted for 10 minutes, immediately ensued when Abu Nibras detected the presence of the Marines, NFWM commander also said.

Medina added that an adult female and a minor was found dead in the encounter site, while three other minors, who sustained wounds were immediately given first aid and transferred to a medical facility for emergency treatment. The adult female and minors are believed to be the wife and children of the neutralized Abu, he said.

Further, representatives from PNP-SOCO and Police Station-1 Brgy Vitali, Zamboanga City that conducted search and investigation at the encounter site found the following: one M16 rifle with 5 short and 4 long magazines all loaded with ammunition, various bomb making components such as Ammonium Nitrate, glass bottles and nails commonly used to create Improvised Explosive devices (IEDs) were also found.

Alias Abu Nibras is one of those wanted by the government and is included in Arrest Order Number 1 released by President Rodrigo Duterte at the onset of the declaration of martial law in the islands of mindanao May of last year.

As the Commander of the Fleet-Marine Team aboard Western Mindanao region, Rear Adm Rene V Medina applauded the troops of MBLT11 under JTF Zamboanga for the rapid response and vigilance in the performance of their duty to ensure the safety and security of Zamboanga City and Western Mindanao as a whole. (With NFWM PR and photo)

ARMM holds last anniversary celebration

Cotabato City (November 20, 2018) – “Buo ang tiwala ko na ito na ang pinakahuling anibersaryo ng ARMM,” said Governor Mujiv Hataman of the Autonomous Region in Muslim Mindanao (ARMM) during the region’s celebration of its 29th founding anniversary dubbed ‘Pakaradjaan 2018’ on Monday, November 19, at its regional seat here. 

Looking happy yet emotional, Gov. Hataman expressed his gratitude to all the regional government’s partners and stakeholders who have been part of the success of the ARMM. “Hindi ko kayo makakalimutan dahil sa haba ng ating pinagsamahan,” he said.

In the last seven years, the governor stood proud before this crowd stating that his administration has been described as “the youngest, the longest, and the best regional government” in the history of ARMM.

However, Gov. Hataman believes that this year’s celebration of Pakaradjaan is not the end, but the start of new beginnings for the Bangsamoro people through the establishment of the new Bangsamoro government.

He further urged ARMM constituents to support the incoming new Bangsamoro government and participate in the plebiscite on January 21, next year. “Kung mababago ang lahat at makakamit natin ang tunay na kapayapaan, sigurado ako, tayong lahat din ang makikinabang,” he added. 

Meanwhile, ARMM Vice Governor Haroun Al-Rashid Lucman said this celebration is about standing proud in leaving behind ARMM that has been previously stigmatized as a “failed experiment”.

“ARMM has made a remarkable turnaround to become a responsive, efficient, and effective government,” he said. Vice Gov. Lucman gave credit to the workforce of the present administration, and most significantly, to ARMM Governor Hataman for his effort in making ARMM better. 

Thousands of employees from the region’s different offices and line agencies participated in a parade to officially open the anniversary celebration. 

During the event, guests were also present, including Anak Mindanao Executive Director Sitti Djalia Turabin Hataman, Marawi civic leader and senatorial candidate Samira Gutoc, and Basilan Governor Jim S. Hataman Salliman.

Senator Juan Edgardo M. Angara, who was represented by his chief of staff, Alfonso Miguel Lima, said on his message: “naniniwala kami na sa pamamagitan ng Bangsamoro Organic Law (BOL),  masisigurado na imbes baril at granada ang itataas, ay libro at lapis; araro at binhi;pala at semento ang hahawakan ng mgaBangsamoro. Ang kapayapaan ay nakakamit kapag ito ay nakapulupot sa kaunlaran.”

He also said the BOL should be seen not as a break, but as a continuation, an evolution, or an expansion, even of the trajectories that have started in ARMM.

Celebrities from Manila – such as singers Jessa Zaragoza, JBK Band, and comedians GB Labrador and Alex Calleja – graced the event to perform and entertain the audience. 

Representatives from each of ARMM’s five provinces – Maguindanao, Sulu, Lanao del Sur, Basilan and Tawi-Tawi – performed their cultural dance presentations during the program.

ARMM agencies with the most number of contingents and most creative during the parade were also given recognition. These are as follows: 2nd runner up - Department of Education; 1st runner up - Department of Environment and Natural Resources; and winner - Office of the Bangsamoro Youth Affairs and ARMM Development Academy.

The celebration of ‘Pakaradjaan 2018’ started on March 26 and will culminate on December 19. Meanwhile, Gov. Hataman will deliver his last ‘Ulat sa Bayan’ on December 18. (By JONG CADION with Bureau of Public Information)

Navy led Outreach Mission in Misamis Occidental in Time with PN Reservists’ Graduation Rites

PAGADIAN  CITY (Nov. 20, 2018) – The Naval Forces Western Mindanao with the Local Government Unit of Ozamiz City, partner stakeholders and other military units joined force for the conduct of Community Outreach Mission at Brgy Dona Consuelo, Ozamis City on November 18, 2018, Navy Official disclosed.

The CMO Team was led by Naval Forces Western Mindanao Commander, Rear Admiral Rene V Medina AFP and was welcomed by the City Mayor of Ozamiz City and his constituents. The activity kicked-off with a short program.

Rear Admiral Medina said that various services during the Community Outreach Mission were:

•       Medical Consultation to 336 beneficiaries

•       Dental check-up and Tooth Extraction to 60 patients

•       Eye Check-up and Eye Glasses Distribution to 100 individuals

•       Free Haircut to 80 individuals

•       Food feeding to 300 children

•       Distribution of Sardines to 300 families

•       Free Circumcision to 13 youth/children

Further, the residents were entertained by NFWM Band and Magic Show performance of MBLT 11 which enjoyed by the kids and young at hearts. Used clothing and boxes of sardines were also donated by the partner stakeholders to Brgy Doña Consuelo. Trash bins were also turned-over to the said barangay.

The cooperation between the Civil Military Operations Unit-WM; Marine Battalion Landing Team 11; Reservists from 613th Naval ROTC Unit of  Misamis Institute of Technology, 623rd Naval Squadron Reserve under Naval Reserve Center – Western Mindanao (NRCen-WM); Naval Special Operations Unit 6 (NAVSOU6); BRP Waray (LC 288); 10th Infantry Battalion; Medical Team from 1^st Infantry “Tabak” Division, Philippine Army and stakeholders from MEGA Global; Crystal Clear Vision; members of the Philippine Navy Ozamiz Batch 1976; Ozamis City Health Office; Medical doctors and dentists from Mt Malindang Eagles Club; Zamboanga City Grand Eagles Club was proven during the successful conduct of the activity.

With sense of commitment and willingness to serve, these people ably offered their time and expertise to render basic services and uplift the quality of life of the community of Dona Consuelo in Ozamiz City. This is also one way to remind the public that they can always trust and rely on the Philippine Navy and the AFP as a whole.

“Na-a mi karon sa inyong atubangan para maghatag ug libreng serbisyong medical sa ato-ang tanan tungod kay we value health not only for ourselves but also to our fellow Filipinos,” as expressed by the NFWM Commander.

“This is the reason why we have conceptualized and developed this activity so that we can meet the various services nga makahatag sa atoug kaayuhan ug panlawas. It's a free gift from all of us as a sign of our concern and love for you. We've come together, soldiers, government agencies and our private sector partners, to give you the best services we can ever give. Pirmi natinghuna-hunaon nga Kauban ninyo ang inyong Navy ug atong gobyerno sa Kalinaw ug Paglambo.” Medina added.

The Brgy Captain, Hon. Rey T Lapar said that it was the first time that they experienced such outreach mission that offered basic services and they were very thankful that their barangay was the recipient of the efforts and services of the Navy and its partneragencies.

Likewise, the CMO initiatives is in support to Higher Headquarters’ Development Support and Security Plan “KAPAYAPAAN 2017-2022” promoting peace, ensuring security, helping maintain public order and supporting the overall development initiatives of the government.

Also held in the afternoon is the graduation rite of Special Basic Citizen Military Training (SBCMT) Class 24 which was attended by the Commander, NFWM. The graduated reservists were composed of 134 individuals who were trained and equipped by the NRCen-WM with the basic doctrine and knowledge as a military.

These advocacies of the Command are concurrent with the stand of the Philippine Navy to sustain and strengthen its maritime patrol to protect and secure the Philippine waters while helping the community to progress and attain better quality of life. (By JONG CADION with NFWM PR and photos)

PRO9 Holds Seminar-Workshop on Red Teaming in Zamboanga City

ZAMBOANGA CITY (Nov. 15, 2018) - The Police Regional Office 9 holds a 2-day Cascading Seminar-Workshop on Red Teaming from November 12 to 13, 2018 held at the Zamboanga City Disaster Reduction and Risk Management Office (ZCDRRMO), Zamboanga City.

PCSUPT Emmanuel Luis D Licup, Regional Director of PRO9 said that the Seminar/Workshop aims to enlighten the knowledge of the participants from the Zamboanga City Police and Isabela City Police on the concept of Red Teaming to ensure a high degree of alertness, readiness and preparedness in times of the occurrence of devastating events.

Some of the topics discussed during the workshop were: Overview of the CMC 2017-050 “Guidelines and Procedures on PNP Red Teaming”, Media Management in Crisis Situation and the preparation of the Contingency Plan on Major Event Security Framework (MESF).

The Seminar/Workshop was attended by more or less seventy three (73) Red Team members of Zamboanga City Police Office Headquarters, Zamboanga City Police Station 1-11, Zamboanga City Mobile Force Company (ZCMFC) and Isabela City Police Station (ICPS).

PSSUPT Ray Dante Soledad, Chief RPCRD, PRO9 was the keynote speaker during the closing ceremony of the Seminar/Workshop. In his guidance, he encouraged the participants to apply in actual scenarios and situations in their respective AOR the Red Teaming Campaign and Operational Planning, Concept, Doctrine Development, Policy and Strategy Making to ensure the public safety and security of the populace. (By JONG CADION with PRO9 PIO PR and Photos)

Barangay Officials of Poblacion Baroy, Lanao del Norte Launch its own PBBL

By Mike Navarro and Kent Esteban Santos

POBLACION BAROY, Lanao del Norte (Nov. 18, 2018) - The Barangay Officials of PoblacionBaroy Lanao del Norte launch its own PoblacionBaroy Basketball League (PBBL).

The PBBL was lead by Barangay Chairman Karlo Ryan "Yanyan"Basalo and with the full support of re electionistSanguniang Bayan Member Edwin Jun-Jun Ong and the Barangay Council of PoblacionBaroy. The basketball league became more than a success.

Sanguniang Bayan Member Edwin Jun-Jun Ong said "we do have teams composing of drug surrenderees, like TAN’Ders (Tanud + surrenderees), agencies like PNP from lala and Baroy, BFP, TBWD (TubodBaroy Water District), business sectors like of the LBC, RFC, PugonniEmang, 1st Valley Bank, Emma’s Lechon, and many more.it’s hard for me to mention all 21 teams competing the PBBL Championships.”

“I may describe it as phenomenon that a simple league be embraced by so many. This could be the rarest tournament in our province that comes with the most awaited PBBL ALL-STAR weekend, schedule on Nov.30 to Dec. 2. Aside from the all-star game, 3-point shootouts, there’s a lot of challenges to expect from, like the half-court shoot-out challenge in which 2 smartphone could be won,” Ong disclosed.

"This Basketball league is for Fitness,Camaraderie, Youth protection from drugs, Enhancement of sports skills, Productive Social engagement, Alleviate criminal activities and many more,” Ong explained.

“This is actually the answer of our present social issiues and it was responded not only in Baroy but also in Lala and Tubod,” the SB Member Ong said during the exclusive interview of news team.

The PBBL also cater basketball players on the 13 year-old and under category..this young aspiring boys were provided with basketball uniforms, trainings and drills by the Barangay thru their visionary young Chairman YanyanBasalo.

SND Awards E-CLIP to 71 Former Rebels in Mis Occ

By JONG CADION

  

PAGADIAN CITY, Zambo del Sur (Nov, 17, 2018) – At least Seventy-

one Former Rebels (FRs) of Misamis Occidental were awarded with financial assistance of the Enhanced Comprehensive Local Integration Program (E-CLIP) of the government by Sec. Delfin Lorenzana, Department of National Defense, in Provincial Capitol, Oroquieta City Saturday (November 17, 2018)., military official said.

Capt. Clint Antipala, Acting Division Public  Affairs (DPAO)  Chief disclosed that during the awarding ceremony, Sec. Lorenza personally handed over the checks worth Php65,000.00 to former rebels and Php15,000.00 to Yunit Militia members as part of the reintegration and financial assistance of the program.

Capt. Antipala said that the event was attended by Governor Herminia Ramiro, Province of Misamis Occidental; Asec Roosque Calacat, Assistant Secretary for Barangay Affairs and Partnership; Usec Reynaldo Mapagu, Task Force Balik Loob; Vice Governor Virginia Almonte; Major General Roseller Murillo, 1st Infantry Division Commander; E-CLIP committees, PNP, LGUs and other stakeholders.

"Sixty-nine out of seventy-one surrenderees were regular Communist NPA Terrorist members. The two others were Yunit Militia ," said Col. Bagnus Gaerlan, 102nd Infantry Brigade Commander.

"E-CLIP have changed the lives of FRs in Misamis Occidental. With this program, rebels in our province decreased." said Gov. Ramiro.

"To our FRs, there is no turning back, you (FRs) are now our partners for peace and development in our province," she added.

Alias Man-Man, one of the FR, during his testimony mentioned his hardships and struggles while with the NPA armed group.

He likewise thanked the president for the reintegration program.

"The promise of our government is different compared to Communist NPA Terrorist. We fulfil our promise of a good governance, they (NPA) didn’t." said Sec. Lorenzana.

"The E-CLIP thru the leadership of President Duterte is a complete, where convergence of government units and agencies to serve our FRs is being implemented," he added.

"We thanked Gov. Ramiro and the stakeholders of province of Misamis Occidental for being active in implementing the E-CLIP," said Major General Murillo.

Oath of allegiance of FRs was also conducted to pledge for their commitment, loyalty and support to the government.

The E-CLIP seeks to contribute towards achieving the goal of permanent and peaceful closure of all armed conflicts with non-state armed groups. (With DPAO PR and Photos)

Gov. Hataman completes Malaysian university fellowship

Cotabato City (November 17, 2018) – Governor Mujiv Hataman of the Autonomous Region in Muslim Mindanao (ARMM) has completed an academic fellowship program on Wednesday, November 14, at the Universiti Sains Islam Malaysia (USIM).

He received his Certificate of Completion as a fellow of USIM’s International Attachment Program from Prof. Dr. Abdul Rahim Abdul Rahman, Deputy Vice-Chancellor (Academic & International) during a ceremony held in the city of Putrajaya.

The short-term course, which started on September 19th covered the following topics: Islamic leadership and governance; peace tolerance and combating terrorism; sustainable development framework; Islamic micro-finance; endowment; halal management; and community Islamic education.

“The program will help us in ARMM further develop our anti-violent extremism efforts and help the regional government and, hopefully, the next Bangsamoro government on its peace and security objectives,” the governor earlier said.

Prior to entering public service in Mindanao, Gov. Hataman has been very active in the civil society movement, specifically on peace initiatives as well as in efforts to uplift the socioeconomic condition of Moros in Mindanao.

Gov. Hataman’s USIM fellowship is the first awarded to a regional chief executive in Asia as endorsed by the Ministry of Education and Ministry of Foreign Affairs of Malaysia. The ARMM governor was invited by the university through Professor Dato’ Dr. Musa Ahmad, USIM vice-chancellor, facilitated by Dr. Zulkifly Baharom, chief executive officer of the university’s Sejahtera Leadership Initiative.

In a previous statement, the university said the program “constitutes sharing of knowledge, exchanges of ideas, public lectures, and preparation of report covering the specific study on ‘peace, security, anti-violent and extremism program through Islamic leadership and sustainable development approach’.”

It also included relevant site visits as well as courtesy calls on Malaysian officials, such as Federal Ministers, State Chief Ministers, and heads of agencies in relation to topics and discussions covered by the program. (JONG CADION with Bureau of Public Information)

Lanao del Norte Highway Patrol Group continue their operations against violators

      

By Mike Navarro and Kent Esteban Santos

TUBOD, Lanao del Norte (Nov. 14, 2018)–Lanao del Norte Highway Patrol Group head SPO3 LucmanPacaconfiscated more than 214-LED Lights and Blinkerswhich is prohibited under PD-96 as they continue their month-long operationsagainst the violators.

LTO and HPG continue their road operations in Lanao del Norte against those violators,single motor drivers without helmet,registrations and driver’s license.

"Single motor drivers should wear always a helmet while driving to prevent road accident,"said LTO Lanao del Norte chief Malic Sultan.While HPG Tubod Lanao del Norte head SPO3 LucmanPaca said “that they continue to confiscate the Led lights and blinkers which is prohibited according to PD 96.